PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG028767t1
Common NameTCM_028767
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 754aa    MW: 83174.1 Da    PI: 6.018
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG028767t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-2198153156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Thecc1EG028767t1  98 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 153
                       7999************************************************9877 PP

2START233.65.4e-732694913206
                       HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
             START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                        ++a++el k+a+a+ep+Wv+s+    e++n+de++++f+ +++      +s+ea+r++gvv+ +l++lv++++d++ qW+e+++    k++t
  Thecc1EG028767t1 269 VNQATEELKKMATASEPLWVRSVetgrEILNYDEYVKEFSVENSsngrpkRSIEASRETGVVFVDLPRLVQSFMDVN-QWKEMFPclvsKVAT 360
                       578999*********************************8888899*******************************.*************** PP

                       EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
             START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                       ++vi++g      ga+qlm+aelq+l+plvp R+++fvRy++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksngh+kvtwv
  Thecc1EG028767t1 361 VDVICNGeapnrnGAVQLMFAELQMLTPLVPtREVYFVRYCKQLSAEQWAIVDVSIDKVEENI-DASLVKCRKRPSGCIIEDKSNGHCKVTWV 452
                       *************************************************************98.9**************************** PP

                       E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       eh +++++++h ++r +v+sgla+ga++w+atlq qce+
  Thecc1EG028767t1 453 EHLECQKSTVHTMYRTVVSSGLAFGARHWMATLQLQCER 491
                       *************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-2384149IPR009057Homeodomain-like
SuperFamilySSF466891.5E-2088156IPR009057Homeodomain-like
PROSITE profilePS5007118.2295155IPR001356Homeobox domain
SMARTSM003898.3E-1997159IPR001356Homeobox domain
PfamPF000461.0E-1898153IPR001356Homeobox domain
CDDcd000864.34E-17102153No hitNo description
PROSITE patternPS000270130153IPR017970Homeobox, conserved site
PROSITE profilePS5084839.795258494IPR002913START domain
SuperFamilySSF559611.17E-34260491No hitNo description
CDDcd088751.25E-113262490No hitNo description
Gene3DG3DSA:3.30.530.203.7E-7264484IPR023393START-like domain
SMARTSM002341.1E-75267491IPR002913START domain
PfamPF018521.5E-58268491IPR002913START domain
SuperFamilySSF559611.07E-14521741No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MGVDMSNPPT KDFFASPALS LSLAGIFRDA GAAAAAAAAN MEVEEGDEGS GGGGSGKREE  60
TVEISSENSG PARSRSEDDL LEHDDEEDDG DKSKKKKRKK YHRHTAEQIR EMEALFKESP  120
HPDEKQRQQL SKQLGLAPRQ VKFWFQNRRT QIKAIQERHE NSLLKHELDK LRDDNKAMRE  180
TINKACCPNC GMATTSKDGS VTTEEQQLRI ENAKLKAEVE KLRAAIGKYA PGAASTSSCS  240
AGNDQENRSS LDFYTGIFGL EKSRIMEIVN QATEELKKMA TASEPLWVRS VETGREILNY  300
DEYVKEFSVE NSSNGRPKRS IEASRETGVV FVDLPRLVQS FMDVNQWKEM FPCLVSKVAT  360
VDVICNGEAP NRNGAVQLMF AELQMLTPLV PTREVYFVRY CKQLSAEQWA IVDVSIDKVE  420
ENIDASLVKC RKRPSGCIIE DKSNGHCKVT WVEHLECQKS TVHTMYRTVV SSGLAFGARH  480
WMATLQLQCE RLVFFMATNV PTKDSTGVAT LAGRKSILKL AQRMTWSFCH AIGASSYNTW  540
NKVPSKTGED IRVSSRKNLN DPGEPLGVIV CAVSSVWLPV SPNALFDFLR DEAHRNEWDI  600
MSNGGPVQSI ANLAKGQDRG NAVTIQAMKS KENSMWVLQD SCTNAFESMV IFAPVDIAGM  660
QSVITGCDSS NMAILPSGFS ILPDGLESRP LVITSRQEKS NDTEGGSLLT IAFQILTNSS  720
PTAKLTMESV ESVNTLISCT LRNIKTSLQC EDG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19398KKKKRK
29399KKKKRKK
39599KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5309130.0AF530913.1 Gossypium hirsutum homeodomain protein GhHOX1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007024189.10.0HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A061GB600.0A0A061GB60_THECC; HD-ZIP IV family of homeobox-leucine zipper protein with lipid-binding START domain isoform 1
STRINGPOPTR_0003s05100.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM123702731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]